PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 433aa    MW: 48734.3 Da    PI: 9.2353
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033441genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.46.9e-2589132144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Lus10033441  89 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 132
                  79***************************************997 PP

2QLQ57.34.6e-201044236
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                 +FTa+Q+q+L++Q+l++Ky+a++ P+P++Ll+ i+
  Lus10033441 10 PFTATQWQELEHQALIFKYMASGIPIPHDLLFTIK 44
                 8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-11945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.9271045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.9E-151043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9889133IPR014977WRC domain
PfamPF088791.6E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MSGRSSSRFP FTATQWQELE HQALIFKYMA SGIPIPHDLL FTIKRSSSSS SSSSCLDSSS  60
SLLSSKLFPS QSPHIGWSCF QLGLGRKIDP EPGRCRRTDG KKWRCSKEAY PDSKYCERHM  120
HRGKNRSRKP VEVAATQQQS PLITPLTAKN SSSPPTLLQY PHTSLSLLSS SSSTTTEHQS  180
HQINHHYQHP TPPSGSYNNH HHLFLSSSHA AAVRPQQTND STNLLLDSAG YYSHSNTDYR  240
RNRSIYALKE EVDEHAFFSE TSGSIRSSEE AWRLSPLAIN SSSSSSSSSS SSKQRSSSHQ  300
HQHHHQELQN QNQNQKNDYY SNYLQLQSSD NIDSCTTKNQ NNNGCYIDAA GKSSQSMMRF  360
DRVVNSNEPQ NQKRVHRFFD EWPPRNKESA SWLQLDDKSS LNNTTLSISI PNSTSTMDLP  420
IFGSRTSYHQ QQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4680354e-43AM468035.1 Vitis vinifera contig VV78X155042.5, whole genome shotgun sequence.
GenBankAP0098464e-43AP009846.1 Lotus japonicus genomic DNA, clone: LjT02E24, TM1624a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381639.11e-122hypothetical protein POPTR_0006s14560g
RefseqXP_011045983.11e-122PREDICTED: growth-regulating factor 1 isoform X2
TrEMBLU5GAT51e-122U5GAT5_POPTR; Uncharacterized protein
STRINGPOPTR_0006s14560.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-49growth-regulating factor 5